Description

TB-500 5mg – Premium Research Peptide

TB-500, available at 5mg, is a premium-grade research peptide designed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are essential.

Product Details:

• Name: TB-500 5mg
• Catalogue Number: TB500-5mg
• Chemical Formula: C212H350N56O78S
• Molecular Weight: 4963.4 g/mol
• Purity Level: ≥98%
• Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Physical Form: Lyophilized Powder

Usage and Storage:
TB-500 is supplied as a lyophilized powder to ensure maximum stability and ease of use in research settings. For optimal results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:
TB-500 is meticulously synthesized through a controlled process that ensures high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence guarantees that each batch undergoes rigorous quality control to meet the high standards required by researchers.

Regulatory and Safety Notes:
Peptide Labs proudly offers TB-500 strictly for scientific and research purposes. In support of the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not intended for human consumption or clinical use.

For researchers in need of high-quality TB-500, Peptide Labs provides a reliable source designed for precision and innovation in scientific studies.