Sale!

TB500 Bundle – 25mg

Original price was: £99.95.Current price is: £89.95.

Description

5 x Vials of TB500 (Thymosin Beta 4) | Save £10

This product is five single vials of 5mg, which equals 25mg

All vials of TB500 will come in a lyophilised, freeze-dried form

TB-500, available at 5mg, is a premium-grade research peptide designed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are essential.

Product Details:

Name: TB-500 5mg
Catalogue Number: TB500-5mg
Chemical Formula: C212H350N56O78S
Molecular Weight: 4963.4 g/mol
Purity Level: ≥98%
Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Physical Form: Lyophilized Powder
Usage and Storage:
TB-500 is supplied as a lyophilized powder to ensure maximum stability and ease of use in research settings. For optimal results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:
TB-500 is meticulously synthesized through a controlled process that ensures high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence guarantees that each batch undergoes rigorous quality control to meet the high standards required by researchers.

Regulatory and Safety Notes:
Peptide Labs proudly offers TB-500 strictly for scientific and research purposes. In support of the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not intended for human consumption or clinical use.

For researchers in need of high-quality TB-500, Peptide Labs provides a reliable source designed for precision and innovation in scientific studies.

 

Specifications

Physical and chemical properties
Molecular Formula C212H350N56O78S
Molecular Weight 4963.44
Physical Appearance White lyophilised solid
Purity >98%
Peptide Sequence Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Form & Formulations Sterile filtered white lyophilized (freeze-dried)
Solubility Aqueous soluble
Storage Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Analytical Data
HPLC Shows min 98% purity
Mass Spectrum Consistent with structure
Research use
Caution Research use only / Not for human or veterinary use

Certificate of Anaylysis