Description
5 x Vials of TB500 & 5 x Vials of BPC157 | Save £20
This product is:
five single vials of 5mg TB500, which equals 25mg
five single vials of 5mg BPC157, which equals 25mg
a total of 50mg of peptide in this bundle
Product Details:
- Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Chemical Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Purity Level: 99%
- Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Physical Form: Lyophilized Powder
- Usage and Storage: TB-500 is supplied as a lyophilized powder to ensure maximum stability and ease of use in research settings. For optimal results, follow our website’s detailed reconstitution and storage guidelines.
- Name: BPC-157 5mg
- Catalogue Number: BPC5-024
- Chemical Formula: C62H98N16O22
- Molecular Weight: 1479.6 g/mol
- Purity Level: 99%
- Amino Acid Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
- Physical Form: Lyophilized Powder