wolverine stack peptide
wolverine stack peptide

TB500 & BPC157 Bundle – 10mg

£32.90

Quick Buy
Category: Tags: , , , , ,

Description

1 x Vials of TB500 & 1 x Vials of BPC157 | Save £3

This product is:

one vial of 5mg TB500
one vial of 5mg BPC157

a total of 10mg of peptide in this bundle

Product Details:

  • Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Chemical Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity Level: 99%
  • Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Physical Form: Lyophilized Powder
  • Usage and Storage: TB-500 is supplied as a lyophilized powder to ensure maximum stability and ease of use in research settings. For optimal results, follow our website’s detailed reconstitution and storage guidelines.

 

  • Name: BPC-157 5mg
  • Catalogue Number: BPC5-024
  • Chemical Formula: C62H98N16O22
  • Molecular Weight: 1479.6 g/mol
  • Purity Level: 99%
  • Amino Acid Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
  • Physical Form: Lyophilized Powder

 

Specifications

Physical and chemical properties
Molecular Formula C212H350N56O78S
Molecular Weight 4963.44
Physical Appearance White lyophilised solid
Purity >98%
Peptide Sequence Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Form & Formulations Sterile filtered white lyophilized (freeze-dried)
Solubility Aqueous soluble
Storage Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Analytical Data
HPLC Shows min 98% purity
Mass Spectrum Consistent with structure
Research use
Caution Research use only / Not for human or veterinary use
Physical and chemical properties
Molecular Formula C62H98N16O22
Molecular Weight 1419.556 g/mol
Storage Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Research use
Caution Research use only / Not for human or veterinary use

Related products